elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS

Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS

Instruction Manual!

Product name: Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol,pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human Methenyl-THF synthetase is produced by our E.coli expression system and the target gene encoding Met1-Ala203 is expressed with a 6His tag at the C-terminus.
Names 5-formyltetrahydrofolate cyclo-ligase,5,10-methenyl-tetrahydrofolate synthetase,MTHFS,Methenyl-THF synthetase
Accession # P49914
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol,pH 8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETE EIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLD LIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEV LYEDSSTALEHHHHHH
Background 5-formyltetrahydrofolate cyclo-ligase (MTHFS) belongs to the 5-formyltetrahydrofolate cyclo-ligase family. It is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, contributes to tetrahydrofolate metabolism. MTHFS helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese