Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS
Product name: | Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase/MTHFS |
Source: | E. coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol,pH 8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human Methenyl-THF synthetase is produced by our E.coli expression system and the target gene encoding Met1-Ala203 is expressed with a 6His tag at the C-terminus. |
Names | 5-formyltetrahydrofolate cyclo-ligase,5,10-methenyl-tetrahydrofolate synthetase,MTHFS,Methenyl-THF synthetase |
Accession # | P49914 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris,200mM Nacl,1mM DTT,50% Glycerol,pH 8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETE EIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLD LIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEV LYEDSSTALEHHHHHH
|
Background | 5-formyltetrahydrofolate cyclo-ligase (MTHFS) belongs to the 5-formyltetrahydrofolate cyclo-ligase family. It is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, contributes to tetrahydrofolate metabolism. MTHFS helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. |