elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human High Mobility Group Protein B1/HMGB1

Recombinant Human High Mobility Group Protein B1/HMGB1 Recombinant Human High Mobility Group Protein B1/HMGB1

Instruction Manual!

Product name: Recombinant Human High Mobility Group Protein B1/HMGB1
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 50mM HEPES-Na,p H 7.9,500mM NaCl,0.6mM DTT.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human High mobility group protein B1 is produced by our E.coli expression system and the target gene encoding Pro92-Val176 is expressed with a MARI tag at the N-terminus.
Names High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMGB1, HMG1
Accession # P09429
Formulation Lyophilized from a 0.2 μm filtered solution of 50mM HEPES-Na,p H 7.9,500mM NaCl,0.6mM DTT.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MARIDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKL KEKYEKDIAAYRAKGKPDAAKKGVV
Background High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese