Recombinant Human Protachykinin-1/TAC1

Instruction Manual!

Product name:	Recombinant Human Protachykinin-1/TAC1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH 8.0(10% glycerol 2M Urea).
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Protachykinin-1 is produced by our E.coli expression system and the target gene encoding Glu20-Arg129 is expressed with a 6His tag at the N-terminus.
Names	Protachykinin-1,PPT,TAC1
Accession #	P20366
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH 8.0(10% glycerol 2M Urea).
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQ FFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERR R
Background	Protachykinin-1(TAC1) is a secreted protein and belongs to the tachykinin family. TAC1 is encoded by the TAC1 gene. This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues.