Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein/OASLOASL

Instruction Manual!

Product name:	Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein/OASLOASL
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human OASL is produced by our E.coli expression system and the target gene encoding Met1-His100 is expressed with a 6His tag at the C-terminus.
Names	2'-5'-oligoadenylate synthase-like protein,2'-5'-OAS-related protein,2'-5'-OAS-RP,59 kDa 2'-5'-oligoadenylate synthase-like protein,Thyroid receptor-interacting protein 14,TR-interacting protein 14,TRIP-14,p59OASL,OASL,TRIP14
Accession #	Q15646
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVV KVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHLEHHHHHH
Background	2'-5'-oligoadenylate synthase-like protein (OASL) contains 2 ubiquitin-like domains, and belongs to the 2-5A synthase family. The ubiquitin-like domains are essential for its antiviral activity. OASL can be induced by type I interferon (IFN) and viruses, and expressed in most tissues such as primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis. OASL can specifically interacts with the ligand binding domain of the thyroid receptor (TR) without the presence of thyroid hormone. It does not have 2'-5'-OAS activity, but can bind double-stranded RNA. It also displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.