elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA

Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA

Instruction Manual!

Product name: Recombinant Human Platelet-Derived Growth Factor AA/PDGF-AA
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
SourceE. coliDescriptionRecombinant Human Platelet-derived growth factor AA is produced by our E.coli expression system and the target gene encoding Ser87-Thr211 is expressed.NamesPlatelet-derived growth factor subunit A,PDGF subunit A,PDGF-1,Platelet-derived growth factor A chain,Platelet-derived growth factor alpha polypeptide, PDGFA,PDGF1Accession #P04085FormulationLyophilized from a 0.2 μm filtered solution of PBS,pH7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVK VAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
BackgroundPlatelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese