Recombinant Human NPDC1/CAB1

Instruction Manual!

Product name:	Recombinant Human NPDC1/CAB1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human NPDC1 is produced by our Mammalian expression system and the target gene encoding Gly35-Asp181 is expressed with a 6His tag at the C-terminus.
Names	Neural proliferation differentiation and control protein 1，NPDC-1，NPDC1，RP11-229P13.1, CAB, CAB-1, CAB1
Accession #	Q9NQX5
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEI DFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVS SDPVHMSPLEPRGGQGDVDHHHHHH
Background	Neural proliferation differentiation and control protein 1(NPDC1) is a protein that in humans is encoded by the NPDC1 gene. It is a single-pass membrane protein and belongs to the NPDC1/cab-1 family. The protein strongly expressed in adult brain and especially in hippocampus, frontal lobe and temporal lobe. The protein suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation and it might be involved in transcriptional regulation.