Recombinant Human Cryptic Protein

Instruction Manual!

Product name:	Recombinant Human Cryptic Protein
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cryptic is produced by our Mammalian expression system and the target gene encoding Met1-Gly169 is expressed with a 6His tag at the C-terminus.
Names	Cryptic protein，Cryptic family protein 1，CFC1
Accession #	P0CG37
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSA EGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGA WTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGVDHHHHHH
Background	Cryptic (CFC1) is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. It contains an EGF-like domain, and is glycosylated on its N-terminal during post-translational modification. Cryptic is identified as a NODAL coreceptor involved in the correct establishment of the left-right axis. It may play a role in mesoderm and/or neural patterning during gastrulation. The unnormal expression of this gene may causes a series of diseases such as HTX2, Transposition of the great arteries dextro-looped 2, and Conotruncal heart malformations.