Recombinant Human Serine Protease HTRA2/HTRA2/Omi

Instruction Manual!

Product name:	Recombinant Human Serine Protease HTRA2/HTRA2/Omi
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human HTRA2 is produced by our Mammalian expression system and the target gene encoding Ala134-Glu458 is expressed with a 6His tag at the C-terminus.
Names	Serine protease HTRA2, mitochondrial,High temperature requirement protein A2,HtrA2,Omi stress-regulated endoprotease,Serine protease 25,Serine proteinase OMI,HTRA2,OMI, PRSS25
Accession #	O43464
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAH VVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSP FALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAG ISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLI HKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE VDHHHHHH
Background	High temperature requirement protein A2(HTRA2) is a single-pass membrane protein .It contains 1 PDZ (DHR) domain and belongs to the peptidase S1C family. HtrA2 can be released from the mitochondria during apoptosis and uses its four most N-terminal amino acids to mimic a caspase and be recruited by IAP caspase inhibitors such as XIAP and CIAP1/2. It promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. The protein cleaves THAP5 and promotes its degradation during apoptosis.