Recombinant Human Teratocarcinoma-Derived Growth Factor 1/TDGF1/Cripto
| Product name: | Recombinant Human Teratocarcinoma-Derived Growth Factor 1/TDGF1/Cripto |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Teratocarcinoma-derived growth factor 1 is produced by our Mammalian expression system and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus. |
| Names | Teratocarcinoma-derived growth factor 1,Cripto-1 growth factor,CRGF,Epidermal growth factor-like cripto protein CR1,TDGF1,CRIPTO |
| Accession # | P13385 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFC ACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVA SRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
| Background | Teratocarcinoma-derived growth factor 1(TDGF1) is a Cell membrane protein and contains 1 EGF-like domain. The protein plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. It also may play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. |












