Recombinant Human Parathyroid Hormone 1 Receptor/PTH1R

Instruction Manual!

Product name:	Recombinant Human Parathyroid Hormone 1 Receptor/PTH1R
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Parathyroid hormone 1 receptor is produced by our Mammalian expression system and the target gene encoding Tyr23-Met189 is expressed with a 6His tag at the C-terminus.
Names	Parathyroid hormone 1 receptor,PTH1R
Accession #	Q0VGD7
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	YALVDADDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKL YPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNG SWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMVDHHHHHH
Background	Parathyroid hormone 1 receptor(PTH1R) is a multi-pass membrane protein. The protein is expressed in high levels in bone and kidney and regulates calcium ionhomeostasis through activation of adenylate cyclase and phospholipase C. In bone, it is expressed on the surface of osteoblasts. When the receptor is activated through PTH binding, osteoblasts express RANKL (Receptor Activator of Nuclear Factor kB Ligand), which binds to RANK (Receptor Activator of Nuclear Factor kB) on osteoclasts. This turns on osteoclasts to ultimately increase the resorption rate.