Recombinant Human Ribosomal Protein S6 Kinase α-1/RPS6KA1/RSK1
Product name: | Recombinant Human Ribosomal Protein S6 Kinase α-1/RPS6KA1/RSK1 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 50mM Tris,150mM NaCl,0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF,25% glycerol, pH 7.5. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human Ribosomal protein S6 kinase alpha-1 is produced by our Mammalian expression system and the target gene encoding Met1-Leu735 is expressed with a 6His tag at the C-terminus. |
Names | Ribosomal protein S6 kinase alpha-1;S6K-alpha-1;90 kDa ribosomal protein S6 kinase 1;p90-RSK 1;p90RSK1;p90S6K;MAP kinase-activated protein kinase 1a;MAPK-activated protein kinase 1a;MAPKAP kinase 1a;MAPKAPK-1a;Ribosomal S6 kinase 1;RSK-1;MAPKAPK1A; RSK1;RPS6KA1 |
Accession # | Q15418 |
Formulation | Supplied as a 0.2 μm filtered solution of 50mM Tris,150mM NaCl,0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF,25% glycerol, pH 7.5. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELL KVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYA FQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILL DEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSL PFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTID WNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDD GKPRAPQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRD PSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIG KTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEV LKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKD LVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLK PIESSILAQRRVRKLPSTTLVDHHHHHH
|
Background | Ribosomal protein S6 kinase alpha-1(RPS6KA1) contains 1 AGC-kinase C-terminal domain, contains 2 protein kinase domains and belongs to the protein kinase superfamily. In fibroblast, RPS6KA1 is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA),It phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal,it acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. |