elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Ribosomal Protein S6 Kinase α-1/RPS6KA1/RSK1

Recombinant Human Ribosomal Protein S6 Kinase α-1/RPS6KA1/RSK1 Recombinant Human Ribosomal Protein S6 Kinase α-1/RPS6KA1/RSK1

Instruction Manual!

Product name: Recombinant Human Ribosomal Protein S6 Kinase α-1/RPS6KA1/RSK1
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 50mM Tris,150mM NaCl,0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF,25% glycerol, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Ribosomal protein S6 kinase alpha-1 is produced by our Mammalian expression system and the target gene encoding Met1-Leu735 is expressed with a 6His tag at the C-terminus.
Names Ribosomal protein S6 kinase alpha-1;S6K-alpha-1;90 kDa ribosomal protein S6 kinase 1;p90-RSK 1;p90RSK1;p90S6K;MAP kinase-activated protein kinase 1a;MAPK-activated protein kinase 1a;MAPKAP kinase 1a;MAPKAPK-1a;Ribosomal S6 kinase 1;RSK-1;MAPKAPK1A; RSK1;RPS6KA1
Accession # Q15418
Formulation Supplied as a 0.2 μm filtered solution of 50mM Tris,150mM NaCl,0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF,25% glycerol, pH 7.5.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELL KVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYA FQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILL DEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSL PFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTID WNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDD GKPRAPQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRD PSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIG KTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEV LKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKD LVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLK PIESSILAQRRVRKLPSTTLVDHHHHHH
Background Ribosomal protein S6 kinase alpha-1(RPS6KA1) contains 1 AGC-kinase C-terminal domain, contains 2 protein kinase domains and belongs to the protein kinase superfamily. In fibroblast, RPS6KA1 is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA),It phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal,it acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese