Recombinant Human VAMPB/VAPB
Product name: | Recombinant Human VAMPB/VAPB |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E.coli |
Description | Recombinant Human VAMPB is produced by our E.coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus. |
Names | Vesicle-associated membrane protein-associated protein B/C,VAMP-B/VAMP-C,VAMP-associated protein B/C,VAP-B/VAP-C |
Accession # | O95292 |
Formulation | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGA SINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAEND KPLEHHHHHH
|
Background | vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation. |