Recombinant Human IL-1 Receptor-Like 1/IL-1RL1/ST2

Instruction Manual!

Product name:	Recombinant Human IL-1 Receptor-Like 1/IL-1RL1/ST2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Interleukin-1 receptor-like 1 is produced by our Mammalian expression system and the target gene encoding Lys19-Phe328 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-1 receptor-like 1,Protein ST2,DER4, ST2, T1
Accession #	Q01638-2
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSG IYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWF KNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPV IGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSN GLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECFVDHHHHHH
Background	Interleukin 1 receptor-like 1(IL1RL1) is a member of the interleukin-1 receptor family, Contains 3 Ig-like C2-type domains and 1 TIR domain. It is highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. IL1RL1 is a receptor for interleukin-33, its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL1RL1 may possibly be involved in helper T-cell function. Soluble IL1RL1 also acts as a negative regulator of Th2 cytokine production, it directly implicated in the progression of cardiac disease.