elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Kelch-Like protein 41/Kell/CD238

Recombinant Human Kelch-Like protein 41/Kell/CD238 Recombinant Human Kelch-Like protein 41/Kell/CD238

Instruction Manual!

Product name: Recombinant Human Kelch-Like protein 41/Kell/CD238
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Kelch-like protein 41 is produced by our Mammalian expression system and the target gene encoding Asn68-Trp732 is expressed with a 6His tag at the C-terminus.
Names Kell blood group glycoprotein, CD238, KEL
Accession # P23276
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
NFQNCGPRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRI LEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLL MSQYGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREYLTYLNQLGTLLG GDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQMVTIDQLKEMAPAIDWLSCLQATFTPM SLSPSQSLVVHDVEYLKNMSQLVEEMLLKQRDFLQSHMILGLVVTLSPALDSQFQEARRKLSQKL RELTEQPPMPARPRWMKCVEETGTFFEPTLAALFVREAFGPSTRSAAMKLFTAIRDALITRLRNL PWMNEETQNMAQDKVAQLQVEMGASEWALKPELARQEYNDIQLGSSFLQSVLSCVRSLRARIVQS FLQPHPQHRWKVSPWDVNAYYSVSDHVVVFPAGLLQPPFFHPGYPRAVNFGAAGSIMAHELLHIF YQLLLPGGCLACDNHALQEAHLCLKRHYAAFPLPSRTSFNDSLTFLENAADVGGLAIALQAYSKR LLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRC ARGALLNPSSRCQLWVDHHHHHH
Background Kell blood group glycoprotein (KEL) is a single-pass type II membrane protein which belongs to the peptidase M13 family. It is expressed in Expressed at high levels in erythrocytes and testis, and, at lower levels, in skeletal muscle, tonsils, lymph node, spleen and appendix. KEL has been shown zinc endopeptidase with endothelin-3-converting enzyme activity. It cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. It links via a single disulfide bond to the XK membrane protein that carries the Kx antigen.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese