Recombinant Human Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b

Instruction Manual!

Product name:	Recombinant Human Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Lys288-Ser461 is expressed with a 6His tag at the C-terminus.
Names	Tumor necrosis factor receptor superfamily member 1B,Tumor necrosis factor receptor 2,TNF-R2,Tumor necrosis factor receptor type II,TNF-RII,TNFR-II,p75,p80 TNF-alpha receptor
Accession #	P20333
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KKKPLCLQREAKVPHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPG VEASGAGEARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPK DEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPSVDHHHHHH
Background	Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B) is expressed by the gene TNFRSF1B. The soluble form is produced from the membrane form by proteolytic processing. It can bind to TRAF2, and interacts with BMX. It can act as the receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha.