| ELISA kit |
| Clinical diagnosis |
| Trfia |
| ANTIBODIES |
| CLIA kits |
| Proteins |
| New Products |
| > Human |
| > Canine |
| > Bovine |
| > Equine |
| > Fish |
| > Mouse |
| > Rat |
| > Chicken |
| > Porcine |
| > Rabbit |
| > Goat |
| > Simian |
| > General |
| > Cavia |
| > Caprine |
| > Sheep |
| > Cattle |
Recombinant Human Airway Trypsin-Like Protease 5/HATL5/TMPRSS11B
Instruction Manual!
| Product name: | Recombinant Human Airway Trypsin-Like Protease 5/HATL5/TMPRSS11B |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
SourceHuman CellsDescriptionRecombinant Human Airway Trypsin-Like Protease 5 is produced by our Mammalian expression system and the target gene encoding Leu39-Leu416 is expressed with a 6His tag at the C-terminus.NamesTransmembrane Protease Serine 11B, Airway Trypsin-Like Protease 5, TMPRSS11B, HATL5Accession #Q86T26FormulationSupplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
LAVEKTYYYQGDFHISGVTYNDNCENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLL PNANGSNVQLQLKFKFPPAEGVSMRTKIKAKLHQMLKNNMASWNAVPASIKLMEISKAASEMLTN NCCGRQVANSIITGNKIVNGKSSLEGAWPWQASMQWKGRHYCGASLISSRWLLSAAHCFAKKNNS KDWTVNFGVVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKL SENDNVVVTGWGTLYMNGSFPVILQEAFLKIIDNKICNASYAYSGFVTDSMLCAGFMSGEADACQ NDSGGPLAYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKTGLVDHHHHHH
BackgroundTransmembrane Protease Serine 11B (TMPRSS11B) is a single-pass type II membrane protein member of the peptidase S1 family. TMPRSS11B contains one peptidase S1 domain and one SEA domain. TMPRSS11B is a serine protease that may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
