Recombinant Human Galectin-14/LGALS14

Instruction Manual!

Product name:	Recombinant Human Galectin-14/LGALS14
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tri,100mM NaCl,1mM DTT,20% glycerol,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus.
Names	Placental Protein 13-Like, Charcot-Leyden Crystal Protein 2, CLC2, Galectin-14, Gal-14, LGALS14, PPL13
Accession #	Q8TCE9
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tri,100mM NaCl,1mM DTT,20% glycerol,pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMN SRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDI SLTRVLISDVDHHHHHH
Background	Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind β-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.