Recombinant Human S100 Calcium Binding Protein A8/A9 HeterodimeR

Instruction Manual!

Product name:	Recombinant Human S100 Calcium Binding Protein A8/A9 HeterodimeR
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HEPES,10%Glycerol,150mM NaCl,2.5mM EDTA,pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human S100A8 & S100A9 Heterodimer is produced by our E.coli expression system and the target gene encoding Met1-Glu93(S100A8)&Thr2-Pro114(S100A9) is expressed with a 6His tag at the C-terminus.
Names	S100A8/S100A9 Heterodimer
Accession #	P05109 & P06702
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HEPES,10%Glycerol,150mM NaCl,2.5mM EDTA,pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGA VNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&TCKMSQLERNIETIINTFHQYSVKLGHPDT LNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHE GDEGPGHHHKPGLGEGTP
Background	S100A8 is a member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is produced by neutrophils and monocytes, and forms Ca2+-dependent heterodimer/heterotetramer complexes (termed calprotectin) with S100A9. Calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase.