Recombinant Human Cyclin-H/CCNH

Instruction Manual!

Product name:	Recombinant Human Cyclin-H/CCNH
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,2mM EDTA,2mM DTT,30%Glycerol,pH8.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Cyclin-H is produced by our E.coli expression system and the target gene encoding Met1-Leu323 is expressed with a 6His tag at the N-terminus.
Names	Cyclin-H,CCNH,MO15-associated protein,p34,p37
Accession #	P51946
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,2mM EDTA,2mM DTT,30%Glycerol,pH8.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDP VFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF LACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK TRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSK KSKHEEEEWTDDDLVESL
Background	Human CCNH, also known as Cyclin-H，MO15-associated protein，p34 and p37, is a protein which belongs to the highly conserved cyclin family. Cyclin family members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1.CCNH regulates CDK7 which is the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. CCNH is also involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.