Recombinant Human Acylphosphate Phosphohydrolase 2/ACYP2

Instruction Manual!

Product name:	Recombinant Human Acylphosphate Phosphohydrolase 2/ACYP2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Acylphosphate phosphohydrolase 2 is produced by our E.coli expression system and the target gene encoding Ser2-Tyr99 is expressed with a GST tag at the N-terminus.
Names	Acylphosphatase-2,ACYP2,Acylphosphatase, muscle type isozyme,Acylphosphate phosphohydrolase 2,ACYP
Accession #	P14621
Formulation	Supplied as a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKI GVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSIRY
Background	ACYP2, also known as Acylphosphatase-2, Acylphosphatase, muscle type isozyme, Acylphosphate phosphohydrolase 2, is a protein which belongs to the acylphosphatase family.ACYP2 contains one acylphosphatase-like domain. Muscle acylphosphatase and erythrocyte acylphosphatase have been isolated.ACYP2 plays an important role in hydrolyzing the phosphoenzyme intermediate of different membrane pumps. Recombinant human ACYP2 protein, fused to GST-tag at N-terminus, was expressed in E. coli.