Recombinant Human S100 Calcium Binding Protein A6/S100A6

Instruction Manual!

Product name:	Recombinant Human S100 Calcium Binding Protein A6/S100A6
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human S100 calcium binding protein A is produced by our E.coli expression system and the target gene encoding Met1-Gly90 is expressed with a 6His tag at the N-terminus.
Names	S100A6,Protein S100-A6,Calcyclin,Growth factor-inducible protein 2A9,MLN 4,Prolactin receptor-associated protein,PRA,S100 calcium-binding protein A6,CACY
Accession #	P06703
Formulation	Supplied as a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTI GSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Background	S100A6, also known as Protein S100-A6, Calcyclin, Growth factor-inducible protein 2A9, MLN 4, Prolactin receptor-associated protein, PRA, S100 calcium-binding protein A6 and CACY, is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs.S100 proteins are a family of low molecular weight protein found in vertebrates and localized in the cytoplasm and/or nucleus of a wide range of cells.S100 proteins are involved in a number of fundamental biological processes such as protein phosphorylation, transcription factors, the dynamics of cytoskeleton constituents, enzyme activities, cell growth and differentiation, the inflammatory response,cell cycle progression and differentiation, stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. S100A6 may function as calcium sensor and modulator, contributing to cellular calcium signaling.It may function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility.