Recombinant Human N-Acyl-Aromatic-L-Amino Acid Amidohydrolase/ACY3

Instruction Manual!

Product name:	Recombinant Human N-Acyl-Aromatic-L-Amino Acid Amidohydrolase/ACY3
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,1mM DTT,10%Glycerol,pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Aminoacylase-3 is produced by our E.coli expression system and the target gene encoding Met1-Ser319 is expressed with a 6His tag at the N-terminus.
Names	N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming),ACY3,Acylase III,Aminoacylase-3,ACY-3,Aspartoacylase-2,Hepatitis C virus core-binding protein 1,HCBP1,HCV core-binding protein 1,ASPA2,ACY3
Accession #	Q96HD9
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,1mM DTT,10%Glycerol,pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRAS FSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFD FVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGL GLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLA GTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEKFTFTV PAMPALTPAPSPAS
Background	Aspartoacylase 3, also known as ACY3, N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming), Acylase III, Aminoacylase-3, Aspartoacylase-2, Aspartoacylase-2, HCV core-binding protein 1 and ASPA2, is a member of the Aspartoacylase subfamily. ACY3 plays an important role in deacetylating mercapturic acids in kidney proximal tubules and acts on N-acetyl-aromatic amino acids.ACY3 is located in the cytoplasm of S2 and S3 proximal tubules and the apical domain of S1 proximal tubules. ACY3 protein is also expressed at low levels in stomach, testis, heart, brain, lung and liver, and may function as an HCV (Hepatitis C virus) core binding protein.