Recombinant Human Butyrophilin 3A3/BTN3A3
| Product name: | Recombinant Human Butyrophilin 3A3/BTN3A3 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Butyrophilin 3A3 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus. |
| Names | Butyrophilin subfamily 3 member A3,BTN3A3 |
| Accession # | O00478 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYR GRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYED GGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRN SLLGLEKTASISIADPFFRSAQPWVDHHHHHH
|
| Background | Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response. |












