Recombinant Human Apolipoprotein A-II/ApoA2

Instruction Manual!

Product name:	Recombinant Human Apolipoprotein A-II/ApoA2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Apolipoprotein A-II is produced by our Mammalian expression system and the target gene encoding Gln24-Gln100 is expressed with a 6His tag at the C-terminus.
Names	Apolipoprotein A-II,Apo-AII,Apolipoprotein A2,Truncated apolipoprotein A-II,ProapoA-II,APOA2
Accession #	P02652
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLS YFVELGTQPATQVDHHHHHH
Background	Apolipoprotein A-II(Apo-AII for short), also known as Apolipoprotein A2, is a secreted protein which belongs to the apolipoprotein A2 family. It exists as a disulfide-linked homodimer; and also can form a disulfide-linked heterodimer with APOD. APOA2 is the 2nd most abundant protein of the high density lipoprotein particles. This protein may stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Defects in APOA2 gene might cause apolipoprotein A-II deficiency or hypercholesterolemia.