Recombinant Human Regenerating Islet-Derived Protein 3-γ/Reg3γ/REG3G

Instruction Manual!

Product name:	Recombinant Human Regenerating Islet-Derived Protein 3-γ/Reg3γ/REG3G
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Regenerating islet-derived protein 3-gamma is produced by our Mammalian expression system and the target gene encoding Glu27-Asp175 is expressed with a 6His tag at the C-terminus.
Names	Regenerating islet-derived protein 3-gamma, REG-3-gamma, Pancreatitis-associated protein 1B,REG3G,PAP-1B,Regenerating islet-derived protein III-gamma
Accession #	Q6UW15
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSL VRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFL KWKDYNCDAKLPYVCKFKDVDHHHHHH
Background	Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma, is a secreted protein which contains 1 C-type lectin domain. It is expressed almost exclusively in the pancreas and also expressed in testis, but not found in small intestine. This protein might be a stress protein involved in the control of bacterial proliferation.