Recombinant Human IL-21 Receptor/IL-21R

Instruction Manual!

Product name:	Recombinant Human IL-21 Receptor/IL-21R
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Interleukin-21 Receptor is produced by our Mammalian expression system and the target gene encoding Cys20-Pro236 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-21 receptor,IL-21 receptor, IL-21R, CD360.
Accession #	Q9HBE5
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMD VFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYM LKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTW SEWSDPVIFQTQSEELKEGWNPVDHHHHHH
Background	Interleukin-21 receptor is also known as IL-21 receptor, IL-21R, CD360. In humans, it is encoded by the IL21R gene. It belongs to the type I cytokine receptor family. Type 4 subfamily contains 2 fibronectin type-III domains. Interleukin-21 receptor is selectively expressed in lymphoid tissues and highly expressed in thymus and spleen. IL-21 is produced by CD4+ T cells in response to antigenic stimulation. Its action enhances antigen-specific responses of immune cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells. It also promotes the anti-tumor activity of CD8+ T-cells and NK cells.