Recombinant Human Limbic System-Associated Membrane Protein/LSAMP

Instruction Manual!

Product name:	Recombinant Human Limbic System-Associated Membrane Protein/LSAMP
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LSAMP is produced by our Mammalian expression system and the target gene encoding Val29-Asn315 is expressed with a 6His tag at the C-terminus.
Names	Limbic system-associated membrane protein, LSAMP, IgLON family member 3
Accession #	Q13449
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLE YSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGR PEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITE SKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNY TCVAANKLGVTNASLVLFRPGSVRGINVDHHHHHH
Background	Limbic system-associated membrane protein is also known as LSAMP, IgLON family member 3. In humans, it is encoded by the LSAMP gene. It belongs to the immunoglobulin superfamily and contains 3 Ig-like C2-type domains. Limbic system-associated membrane protein mediates selective neuronal growth and axon targeting. It contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. It is also essential for normal growth of the hyppocampal mossy fiber projection