Recombinant Human Choriogonadotropin Subunit β/CGB5
Product name: | Recombinant Human Choriogonadotropin Subunit β/CGB5 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human Choriogonadotropin subunit beta is produced by our Mammalian expression system and the target gene encoding Ser21-Gln165 is expressed with a 6His tag at the C-terminus. |
Names | Choriogonadotropin subunit beta,CG-beta, Chorionic gonadotrophin chain beta,CGB3,CGB |
Accession # | P01233 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFE SIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPS PSRLPGPSDTPILPQVDHHHHHH
|
Background | Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. |