Recombinant Human Magnesium-Dependent Phosphatase 1/MDP1

Instruction Manual!

Product name:	Recombinant Human Magnesium-Dependent Phosphatase 1/MDP1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Magnesium-dependent phosphatase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ala176 is expressed with a 6His tag at the C-terminus.
Names	Magnesium-dependent phosphatase 1,MDP-1,EC=3.1.3.48,
Accession #	Q86V88
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPG AAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVD VSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEAVDHHHHHH
Background	MDP1, which is short for nesium-dependent phosphatase 1, is a 176 aa. protein. It has 3 forms by different alternative splicing. This protein belongs to the HAD-like hydrolase superfamily, and usually takes its function with Magnesium. It can be inhibited by vanadate and zinc, and slightly by calcium. MDP1 is a Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.