Recombinant Human V-Set and Transmembrane Domain-Containing 2A/VSTM2A

Instruction Manual!

Product name:	Recombinant Human V-Set and Transmembrane Domain-Containing 2A/VSTM2A
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human VSTM2A is produced by our Mammalian expression system and the target gene encoding Ser24-Phe243 is expressed with a 6His tag at the C-terminus.
Names	V-set and transmembrane domain-containing protein 2A,VSTM2
Accession #	Q8TAG5-2
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPEDLDPGAEGAGAQVKLLPDR DPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHKAQAYLKVNANSHA RRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQSGMETHFEP FILPLTNAPQKGQSYRVDRFMNGDFVDHHHHHH
Background	VSTM2A, also called VSTM2, is short for V-set and transmembrane domain-containing protein 2A. It is a 236 aa. protein which can be departed into two parts. The first 24 aa. is a signal peptide, and the last is a V-set and transmembrane domain-containing protein 2A. There is a natural variant location which is E84K.