Recombinant Human Ribonuclease T2/RNASET2

Instruction Manual!

Product name:	Recombinant Human Ribonuclease T2/RNASET2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,20%Glycerol,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Ribonuclease T2 is produced by our Mammalian expression system and the target gene encoding Asp25-His256 is expressed with a 6His tag at the C-terminus.
Names	Ribonuclease T2,3.1.27.-,Ribonuclease 6,RNASE6PL
Accession #	O00584
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,20%Glycerol,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDL LPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKL GIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQ PSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHVDHHHHHH
Background	RNASET2, also known as RNASE6PL, is short for bonuclease T2. It is a 256 aa. protein which belongs to the RNase T2 family. RNASET2 is a secreted protein, and is higher expressed in the temporal lobe and fetal brain. This protein can be inhibited by Zn2+ and Cu2+. It has ribonuclease activity, with higher activity at acidic pH and is probably involved in lysosomal degradation of ribosomal RNA. It also plays a role in cellular RNA catabolism.