Recombinant Human IL-10 Receptor Subunit β/IL-10RB
Product name: | Recombinant Human IL-10 Receptor Subunit β/IL-10RB |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 . |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human IL-10 receptor beta is produced by our Mammalian expression system and the target gene encoding Met20-Ser220 is expressed with a Fc tag at the C-terminus. |
Names | Interleukin-10 receptor subunit beta(IL10RB),Cytokine receptor class-II member 4,Cytokine receptor family 2 member 4,Interleukin-10 receptor subunit 2, |
Accession # | Q08334 |
Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 . |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGD HTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVY NSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTH DETVPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
Background | Interleukin-10 receptor subunit beta(IL10RB), also known as Cytokine receptor class-II member 4,Cytokine receptor family 2 member 4,Interleukin-10 receptor subunit 2, belongs to the type II cytokine receptor family. IL10RB is a single- pass type I membrane protein and contains two fibronectin type-III domains. It is an accessory chain which is essential for the active interleukin 10 receptor complex. Coexpression of IL10RB and IL10RA proteins has been shown to be required for IL10-induced signal transduction. Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25) which is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. |