Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2

Instruction Manual!

Product name:	Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human C-C Motif Chemokine 24 is produced by our Mammalian expression system and the target gene encoding Val27-Cys119 is expressed with a 6His tag at the C-terminus.
Names	C-C motif chemokine 24 (CCL24), CK-beta-6, Eosinophil chemotactic protein, Eotaxin-2, Myeloid progenitor inhibitory factor 2, Small-inducible cytokine A24, Ckb-6, MPIF-2,SCYA24
Accession #	O00175
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDA KQKKASPRARAVAVKGPVQRYPGNQTTCVDHHHHHH
Background	Cytokine are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine. CCL24 diaplays the chemotactic for resting T-lymphocytes and eosinophils. CCL24 has lower chemotatic activity for neutrophils, none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell lines.