elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2/FKBP22/FKBP13

Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2/FKBP22/FKBP13 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2/FKBP22/FKBP13

Instruction Manual!

Product name: Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2/FKBP22/FKBP13
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mm NaCl,pH7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human PPIase FKBP2 is produced by our Mammalian expression system and the target gene encoding Ala22-Leu142 is expressed with a 6His tag at the C-terminus.
Names Peptidyl-prolyl cis-trans isomerase FKBP2(FKBP2 for short), also named 13 kDa FK506-binding protein, FK506-binding protein 2, Immunophilin FKBP13, Rotamase, is a endoplasmic reticulum peripheral membrane protein.
Accession # P26885
Formulation Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mm NaCl,pH7.5.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVI KGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELVDHHHHHH
Background Peptidyl-prolyl cis-trans isomerase FKBP2(FKBP2 for short), also named 13 kDa FK506-binding protein, FK506-binding protein 2, Immunophilin FKBP13, Rotamase, is a endoplasmic reticulum peripheral membrane protein. It contains 1 PPIase FKBP-type domain and belongs to the FKBP-type PPIase family, FKBP2 subfamily which takes part in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP2 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. FKBP2 functions as an ER chaperone and as a component of membrane cytoskeletal scaffolds.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese