Recombinant Human Pregnancy-Specific β-1-Glycoprotein 5/PSG5

Instruction Manual!

Product name:	Recombinant Human Pregnancy-Specific β-1-Glycoprotein 5/PSG5
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Pregnancy-specific beta-1-glycoprotein 5 is produced by our Mammalian expression system and the target gene encoding Gln35-Ile335 is expressed with a 6His tag at the C-terminus.
Names	Pregnancy-specific beta-1-glycoprotein 5, PS-beta-G-5, PSBG-5, Pregnancy-specific glycoprotein 5, Fetal liver non-specific cross-reactive antigen 3, FL-NCA-3
Accession #	Q15238
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDLYHYITSYVVDGQINIYGPAYTGRE TVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTFNLYLKLPKPYITINNSKPRENKDV LAFTCEPKSENYTYIWWLNGQSLPVSPRVKQPIENRILILPSVTRNETGPYECEIRDRDGGMHSD PVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTK HRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPIVDHHHHHH
Background	Pregnancy-specific beta-1-glycoprotein 5, is a secreted protein which belongs to the immunoglobulin superfamily, CEA family. It contains 2 Ig-like C2-type (immunoglobulin-like) domains and 1 Ig-like V-type (immunoglobulin-like) domain