Recombinant Human Probable Serine Carboxypeptidase CPVL/VCP-Like Protein

Instruction Manual!

Product name:	Recombinant Human Probable Serine Carboxypeptidase CPVL/VCP-Like Protein
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Vitellogenic carboxypeptidase-like protein is produced by our Mammalian expression system and the target gene encoding Leu23-Gly476 is expressed with a 6His tag at the C-terminus.
Names	Probable serine carboxypeptidase CPVL, Carboxypeptidase vitellogenic-like, Vitellogenic carboxypeptidase-like protein,VCP-like protein,CPVL
Accession #	Q9H3G5
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTYNSN LFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLYID NPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLI HSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRKQN WFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQ TFNDGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYK KAEKKVWKIFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVGV DHHHHHH
Background	Probable serine carboxypeptidase CPVL, also known as Carboxypeptidase, vitellogenic-like, Vitellogenic carboxypeptidase-like protein, is a member of the peptidase S10 family. It is expressed in macrophages but not in other leukocytes. And specifically, it is abundantly expressed in heart and kidney, also expressed in spleen, leukocytes, and placenta. This enzyme may be involved in the digestion of phagocytosed particles in the lysosome, and also participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.