Recombinant Human Follistatin-Related Protein 1/FSTL1

Instruction Manual!

Product name:	Recombinant Human Follistatin-Related Protein 1/FSTL1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Follistatin-like Protein 1 is produced by our E.coli expression system and the target gene encoding Glu21-Ile308 is expressed.
Names	Follistatin-Related Protein 1, Follistatin-Like Protein 1, FSTL1, FRP
Accession #	Q12841
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLNHCELHRDAC LTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFSKGSNYSEIL DKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLS FQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQT EEEMTRYVQELQKHQETAEKTKRVSTKEI
Background	Follistatin-Related Protein 1 (FSTL1) is a secreted protein that contains two EF-hand domains, one follistatin-like domain, one Kazal-like domain, and one VWFC domain. Its functional significance in physiological and pathological processes is not completely understood. However, FSTL1 is thought to modulate the action of some growth factors on cell proliferation and differentiation. FSTL1 maybe an autoantigen associated with rheumatoid arthritis.