elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2

Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2

Instruction Manual!

Product name: Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human C-C Motif Chemokine 8 is produced by our Mammalian expression system and the target gene encoding Gln24-Pro99 is expressed with a 6His tag at the C-terminus.
Names C-C Motif Chemokine 8, HC14, Monocyte Chemoattractant Protein 2, Monocyte Chemotactic Protein 2, MCP-2, Small-Inducible Cytokine A8, CCL8, MCP2, SCYA10, SCYA8
Accession # P80075
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMK HLDQIFQNLKPVDHHHHHH
Background Human Chemokine (C-C Motif) Ligand 8 (CCL8) is produced by human MG63 osteosarcoma cells. CCL8 shares 62% and 58% amino acid sequence identity with MCP-1 and MCP-3, respectively. All three MCP proteins are monocyte chemoattractants. CCL8 is chemotactic for and activates many different immune cells, including mast cells, eosinophils and basophils, which are implicated in allergic response, and monocytes, T cells, and NK cells that are involved in the inflammatory response. CCL8 elicits its effects by binding to several different cell surface receptors including CCR1, CCR2B and CCR5.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese