Recombinant Human Creatine Kinase, Muscle/CKMM

Instruction Manual!

Product name:	Recombinant Human Creatine Kinase, Muscle/CKMM
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus.
Names	Creatine kinase M-type,Creatine kinase M chain,M-CK,CKM,CKMM
Accession #	P06732
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPG HPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSR VRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFD KPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKI EEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGV DTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH
Background	Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.