elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human β-Casein/CSN2/CASB

Recombinant Human β-Casein/CSN2/CASB Recombinant Human β-Casein/CSN2/CASB

Instruction Manual!

Product name: Recombinant Human β-Casein/CSN2/CASB
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human beta-casein is produced by our E.coli expression system and the target gene encoding Glu26-Val226 is expressed with a 6His tag at the N-terminus.
Names CSN2,CASB
Accession # P05814
Formulation Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLP QNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPL PLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTH QIYPVTQPLAPVHNPISV
Background Beta-casein is a protein that in humans is encoded by the CSN2 gene.Beta-casein is a 226 amino acids protein that belongs to the beta-casein family.It is secreted in milk. Beta-casein palys important role in determination of the surface properties of the casein micelles.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese