Recombinant Human Repulsive Guidance Molecule A/RGMA

Instruction Manual!

Product name:	Recombinant Human Repulsive Guidance Molecule A/RGMA
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Repulsive guidance molecule A is produced by our E.coli expression system and the target gene encoding Pro169-Gly422 is expressed with a 6His tag at the N-terminus.
Names	Repulsive guidance molecule A，RGM domain family member A，RGM
Accession #	Q96B86
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFK NFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQV GRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTA PETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYER TRDLPG
Background	Repulsive guidance molecule A（RGMA） is a cell membrane protein and belongs to the repulsive guidance molecule (RGM) family. It interacts with NEO1, BMP2 and BMP4. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. It helps guide Retinal Ganglion Cell (RGC) axons to the tectum in the midbrain. RGMa has been implicated to play an important role in the developing brain and in the scar tissue that forms after a brain injury. This protein may also function as a tumor suppressor in some cancers.