Recombinant Human Protein Disulfide-Isomerase A5/PDIA5

Instruction Manual!

Product name:	Recombinant Human Protein Disulfide-Isomerase A5/PDIA5
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Protein disulfide-isomerase A5 is produced by our Mammalian expression system and the target gene encoding Ser22-Leu262 is expressed with a 6His tag at the C-terminus.
Names	Protein disulfide-isomerase A5, Protein disulfide isomerase-related protein, PDIA5, PDIR
Accession #	Q9BV43
Formulation	Supplied as a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCG DAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAK DVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFE NIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPLVDHHHHHH
Background	Protein disulfide-isomerase A5 is a 519 amino acids protein that belongs to the protein disulfide isomerase family.It contains 3 thioredoxin domains.It can catalyze the rearrangement of -S-S- bonds in proteins.