Recombinant Human NGAL/Lipocalin-2/LCN2

Instruction Manual!

Product name:	Recombinant Human NGAL/Lipocalin-2/LCN2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS, 50% glycerol,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus.
Names	Neutrophil gelatinase-associated lipocalin, NGAL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin LCN2, p25, HNL, NGAL
Accession #	P80188
Formulation	Supplied as a 0.2 μm filtered solution of PBS, 50% glycerol,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYN VTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNR EYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVDHHHHHH
Background	LCN2 is iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. LCN2 binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. LCN2 is involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. LCN2 is involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.