elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human IL-7 Receptor Subunit α/IL-7RA/CD127

Recombinant Human IL-7 Receptor Subunit α/IL-7RA/CD127 Recombinant Human IL-7 Receptor Subunit α/IL-7RA/CD127

Instruction Manual!

Product name: Recombinant Human IL-7 Receptor Subunit α/IL-7RA/CD127
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant human Interleukin-7 receptor alpha is produced by our Mammalian expression system and the target gene encoding Glu21-Gly236 is expressed with a Fc, 6His tag at the C-terminus.
Names Interleukin-7 receptor subunit alpha,IL7R,IL-7R-alpha,CD127
Accession # P16871
Formulation Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNF RKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTF NTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKG FWSEWSPSYYFRTPEINNSSGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GKHHHHHH
Background Interleukin 7 Receptor alpha (IL-7Rα), also known as CD127, is a 75 kDa hematopoietin receptor superfamily member that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7Rα is majorly expressed on T cells and their precursors, and early in B cell development as well, prior to the appearance of surface IgM. Dynamic regulation of IL-7Rα is important for the generation of appropriate immune responses.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese