elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Neuritin 1-Like Protein/NRN1L

Recombinant Human Neuritin 1-Like Protein/NRN1L Recombinant Human Neuritin 1-Like Protein/NRN1L

Instruction Manual!

Product name: Recombinant Human Neuritin 1-Like Protein/NRN1L
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Neuritin-like protein is produced by our Mammalian expression system and the target gene encoding Ala36-Ala139 is expressed with a 6His tag at the C-terminus.
Names Neuritin-like protein, NRN1L, UNQ2446/PRO5725
Accession # Q496H8
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
AAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQ EARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAVDHHHHHH
Background Neuritin-like protein belongs to the neuritin family. Neuritin is a GPI-anchored protein that promotes neurite outgrowth and branching of neuritic processes in primary hippocampal and cortical cells. Neuritin expression also enhances the development of motor neuron axon arbors by promoting neuromuscular synaptogenesis and by stimulating the addition of new axon branches. Neuritin is induced by neuronal activity and by the neurotrophins, BDNF and NT3. NRN1L contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese