Recombinant Human Type I Inositol 1,4,5-Trisphosphate 5-Phosphatase/INPP5A

Instruction Manual!

Product name:	Recombinant Human Type I Inositol 1,4,5-Trisphosphate 5-Phosphatase/INPP5A
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human INPP5A is produced by our Mammalian expression system and the target gene encoding Met1-Val410 is expressed with a 6His tag at the C-terminus.
Names	Type I inositol 1,4,5-trisphosphate 5-phosphatase, INPP5A
Accession #	Q14642
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASM SHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKV AGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAW ETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADT NEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPP SYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFL AFRIMPGAGKPHAHVHKCCVDHHHHHH
Background	Type I inositol 1,4,5-trisphosphate 5-phosphatase is a 412 amino acids protein that belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type I family. Type I inositol-1,4,5-trisphosphate 5-phosphatase is an enzyme that in humans is encoded by the INPP5A gene. It is expressed in brain and high level in Purkinje cells. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.