Recombinant Human Tsukushin/TSKU

Instruction Manual!

Product name:	Recombinant Human Tsukushin/TSKU
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Tsukushin is produced by our Mammalian expression system and the target gene encoding Thr17-Leu353 is expressed with a 6His tag at the C-terminus.
Names	Tsukushin,Tsukushi,E2-induced gene 4 protein，Leucine-rich repeat-containing protein 54，E2IG4, LRRC54, TSK
Accession #	Q8WUA8
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	TRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTAHLDLSSNRLEMVNESVLAGP GYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREV SVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAGLPAPTIQSLNLAWNRLHAVPNLRDLPLRYLS LDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPGLQVLDLSGNPKLNWAGAEVFS GLSSLQELDLSGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVD TRDSAARGPTILVDHHHHHH
Background	TSKU is a secreted protein and contains 10 LRR (leucine-rich) repeats and 1 LRRNT domain. The alternative splicing of TSK RNA leads to the formation of twoisoforms (TSKA, originally designated as TSK, and TSKB) that differ in their C-terminal region .The crucial function for TSK in promoting formation of the primitive streak and Hensen'snode by positively regulating VG1 activity . In Xenopus embryos, TSK can block BMP function and induce a secondary dorsal axis,while it can dorsalize ventral mesoderm and induce neural tissue in embryonic explants.TSK directly binds VG1 in vitro, and that TSK and VG1functionally interact in axis formation, as shown by biological assays performed in chick and Xenopus embryos .