Recombinant Human TWEAK Receptor/TWEAK R/TNFRSF12A
| Product name: | Recombinant Human TWEAK Receptor/TWEAK R/TNFRSF12A |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human TWEAK Receptor is produced by our Mammalian expression system and the target gene encoding Glu28-Trp79 is expressed with a Fc tag at the C-terminus. |
| Names | TNFRSF12A,Fibroblast growth factor-inducible immediate-early response protein 14, FN14, CD266 antigen and tweak-receptor. |
| Accession # | Q9NP84 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWVDDIEGRMDEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
| Background | Tumor necrosis factor receptor superfamily member 12A(TNFRSF12A) is also known as Fibroblast growth factor-inducible immediate-early response protein 14, FN14, CD266 antigen and tweak-receptor. TNFRSF12A is a single-pass type I membrane protein, including a 27 aa signal peptide, a 53 aa extracellular domain, a 21 aa transmembrane domain and a 28 aa cytoplasmic domain. TNFRSF12A is highly expressed in heart, placenta and kidney. TNFRSF12A can be induced by FGF1 and phorbol ester. TNFRSF12A binds to TWEAK/TNFSF12A to initiate a signal transduction cascade, causing different cellular responses such as cell death, cell proliferation, and angiogenesis. |












