Recombinant Human Regenerating Islet-Derived Protein 4/RELP

Instruction Manual!

Product name:	Recombinant Human Regenerating Islet-Derived Protein 4/RELP
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Regenerating islet-derived protein 4 is produced by our Mammalian expression system and the target gene encoding Asp23-Pro158 is expressed with a 6His tag at the C-terminus.
Names	Regenerating islet-derived protein 4, Gastrointestinal secretory protein, REG-like protein, Regenerating islet-derived protein IV, GISP, RELP, REG4
Accession #	Q9BYZ8
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQ RSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHF LCKYRPVDHHHHHH
Background	REG4 is a secreted contains one C-type lectin domain, high expressed in the gastrointestinal tract, including jejunum, ileum, appendix, pancreas and small intestine. REG4 can be up-regulated by mucosal injury from active Crohn’s disease or ulcerative colitis. In the acid environment, REG4 can maintain carbohydrate recognition activity. REG4 may be involved in inflammatory and metaplastic response of the gastrointestinal epithelium.