Recombinant Human TMIGD2/IGPR-1/CD28H

Instruction Manual!

Product name:	Recombinant Human TMIGD2/IGPR-1/CD28H
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human TMIGD2 is produced by our Mammalian expression system and the target gene encoding Leu23-Gly150 is expressed with a 6His tag at the C-terminus.
Names	Transmembrane and immunoglobulin domain-containing protein 2, Immunoglobulin and proline-rich receptor 1, IGPR1, TMIGD2
Accession #	Q96BF3
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRL SWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGVD HHHHHH
Background	TMIGD2 is a single-pass type I membrane protein, which contains one Ig-like (immunoglobulin-like) domain. It is widely expressed in many tissues, such as epithelial, endothelial cells and lung. However, it isn’t detected in thyroid, cerebellum, thymus and cerebral cortex. TMIGD2 can form homophilic interactions that could regulate cell-cell interaction. It Interacts with CACNB2, DST, MIA and NCKIPSD. It is shown that TMIGD2 plays a role in cell-cell interaction, cell migration, and angiogenesis.